PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010552901.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB
Protein Properties Length: 338aa    MW: 37796.6 Da    PI: 9.592
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010552901.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W+++++  g+ R+ k+c++rw +yl
   XP_010552901.1 14 KGPWTPEEDIILVTYIQEHGPGNWRAVPANTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding42.81.3e-1367143148
                      TSSS-HHHHHHHHHHHHHTTTT..............................-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..............................tWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ ++++ ++lG++                              +W++Ia++++  Rt++++k++w+++l
   XP_010552901.1  67 RGNFTQHEEKMIIHLQALLGNRyatklkaqclssssspmnalnvtcfvgyiyRWAAIASYLP-QRTDNDIKNYWNTHL 143
                      89************************************************************.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.583965IPR017930Myb domain
SMARTSM007171.1E-141363IPR001005SANT/Myb domain
SuperFamilySSF466895.99E-231465IPR009057Homeodomain-like
PfamPF002494.2E-161461IPR001005SANT/Myb domain
CDDcd001674.07E-111661No hitNo description
PROSITE profilePS500908.5662143IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.2E-216587IPR009057Homeodomain-like
SMARTSM007171.6E-1066145IPR001005SANT/Myb domain
PfamPF002497.1E-1167143IPR001005SANT/Myb domain
CDDcd001675.04E-669143No hitNo description
SuperFamilySSF466895.99E-23115144IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-7119158IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-7229258IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MVRPPCCHKE GVKKGPWTPE EDIILVTYIQ EHGPGNWRAV PANTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TQHEEKMIIH LQALLGNRYA TKLKAQCLSS SSSPMNALNV TCFVGYIYRW  120
AAIASYLPQR TDNDIKNYWN THLKKKLNKT PREVDQSDDQ FSTSPSMSSS SANSNSNVSR  180
GQWERHLQTD IHMAKKALFE ALSPSIPIAA TTSSSSESKH SASVSSFLGT QERSNPYASS  240
TDNIAKLLKG WAKNSIKTQD SKNQLASNDF DSKIEIKKGV GIEGGGAFQS FPGFESFRSA  300
VSPDEVKPKP KQSQWSLFEK WLFEDSGDIL LDENPNFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-181414758159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-181414758159MYB PROTO-ONCOGENE PROTEIN
1h8a_C7e-191414727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010552901.10.0PREDICTED: myb-related protein 306-like isoform X1
SwissprotQ9SCU71e-137MYB30_ARATH; Transcription factor MYB30
TrEMBLA0A0D3AWG21e-141A0A0D3AWG2_BRAOL; Uncharacterized protein
STRINGAT3G28910.11e-135(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58422348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.11e-125myb domain protein 30